Lineage for d2hjrh2 (2hjr H:155-326)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233206Species Cryptosporidium parvum [TaxId:5807] [225105] (1 PDB entry)
  8. 2233214Domain d2hjrh2: 2hjr H:155-326 [204581]
    Other proteins in same PDB: d2hjra1, d2hjrb1, d2hjrc1, d2hjrd1, d2hjre1, d2hjrf1, d2hjrg1, d2hjrh1, d2hjri1, d2hjrj1, d2hjrk1, d2hjrl1
    automated match to d5ldha2
    complexed with apr, cit

Details for d2hjrh2

PDB Entry: 2hjr (more details), 2.2 Å

PDB Description: Crystal Structure of Cryptosporidium parvum malate dehydrogenase
PDB Compounds: (H:) malate dehydrogenase

SCOPe Domain Sequences for d2hjrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjrh2 d.162.1.0 (H:155-326) automated matches {Cryptosporidium parvum [TaxId: 5807]}
msgvldsarfrcnlsralgvkpsdvsaivvgghgdemipltssvtiggillsdfveqgki
thsqineiikktafgggeivellktgsafyapaasavamaqaylkdsksvlvcstyltgq
ynvnnlfvgvpvvigkngiedvvivnlsddekslfsksvesiqnlvqdlksl

SCOPe Domain Coordinates for d2hjrh2:

Click to download the PDB-style file with coordinates for d2hjrh2.
(The format of our PDB-style files is described here.)

Timeline for d2hjrh2: