Lineage for d2hiiy2 (2hii Y:128-244)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2216175Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2216176Protein automated matches [226907] (20 species)
    not a true protein
  7. 2216345Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)
  8. 2216357Domain d2hiiy2: 2hii Y:128-244 [204557]
    automated match to d1ud9a2

Details for d2hiiy2

PDB Entry: 2hii (more details), 2.79 Å

PDB Description: heterotrimeric pcna sliding clamp
PDB Compounds: (Y:) pcna2 (sso1047)

SCOPe Domain Sequences for d2hiiy2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hiiy2 d.131.1.0 (Y:128-244) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
efpfkaqlltitfadiidelsdlgevlnihskenklyfevigdlstakvelstdngtlle
asgadvsssygmeyvanttkmrrasdsmelyfgsqiplklrfklpqegygdfyiapr

SCOPe Domain Coordinates for d2hiiy2:

Click to download the PDB-style file with coordinates for d2hiiy2.
(The format of our PDB-style files is described here.)

Timeline for d2hiiy2: