Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Anti-HIV Fv 0.5B, (mouse), kappa L chain [48897] (1 PDB entry) |
Domain d1qnzh_: 1qnz H: [20449] |
PDB Entry: 1qnz (more details)
SCOP Domain Sequences for d1qnzh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anti-HIV Fv 0.5B, (mouse), kappa L chain} qvqlqqsgaelvkpgasvkmsckasgytfttypiewmkqnhgkslewignfhpysddtny nekfkgkakltvekssstvylefsrltsddsavyycaihygsayamdywgqgtsvtvss
Timeline for d1qnzh_: