Lineage for d2h07b1 (2h07 B:3-160)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499680Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2499681Protein automated matches [190891] (38 species)
    not a true protein
  7. 2499802Species Human (Homo sapiens) [TaxId:9606] [225156] (13 PDB entries)
  8. 2499815Domain d2h07b1: 2h07 B:3-160 [204483]
    automated match to d2c4ka1
    complexed with so4; mutant

Details for d2h07b1

PDB Entry: 2h07 (more details), 2.2 Å

PDB Description: crystal structure of human phosphoribosyl pyrophosphate synthetase 1 mutant s132a
PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase I

SCOPe Domain Sequences for d2h07b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h07b1 c.61.1.0 (B:3-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nikifsgsshqdlsqkiadrlglelgkvvtkkfsnqetcveigesvrgedvyivqsgcge
indnlmelliminackiasasrvtavipcfpyarqdkkdksrapisaklvanmlsvagad
hiitmdlhaaqiqgffdipvdnlyaepavlkwirenis

SCOPe Domain Coordinates for d2h07b1:

Click to download the PDB-style file with coordinates for d2h07b1.
(The format of our PDB-style files is described here.)

Timeline for d2h07b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h07b2