Lineage for d2gema2 (2gem A:108-218)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606464Species Salmonella typhimurium [TaxId:602] [225102] (1 PDB entry)
  8. 1606466Domain d2gema2: 2gem A:108-218 [204356]
    automated match to d1okja2

Details for d2gema2

PDB Entry: 2gem (more details), 2.1 Å

PDB Description: 2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a
PDB Compounds: (A:) Putative Gram negative resuscitation promoting factor

SCOPe Domain Sequences for d2gema2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gema2 c.55.1.0 (A:108-218) automated matches {Salmonella typhimurium [TaxId: 602]}
atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw
sawpdlakecgltlhdgevslpaaedmlpiasqklaagetvavehaepvyl

SCOPe Domain Coordinates for d2gema2:

Click to download the PDB-style file with coordinates for d2gema2.
(The format of our PDB-style files is described here.)

Timeline for d2gema2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gema1