Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (42 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [225103] (3 PDB entries) |
Domain d2gelg2: 2gel G:108-218 [204354] automated match to d1okja2 |
PDB Entry: 2gel (more details), 2.05 Å
SCOPe Domain Sequences for d2gelg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gelg2 c.55.1.0 (G:108-218) automated matches {Salmonella typhimurium [TaxId: 99287]} atrvlaaidarmgevywaeyqrdaqgvwqgeeteavlkpervgerlkqlsgewatvgtgw sawpdlakecgltlhdgevslpaaedmlpiasqklaagetvavehaepvyl
Timeline for d2gelg2: