SCOPe 2.08: Domain d1dqmh1: 1dqm H:2-113

Lineage for d1dqmh1 (1dqm H:2-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)

8. Domain d1dqmh1: 1dqm H:2-113 [20427]
   Other proteins in same PDB: d1dqmh2, d1dqml1, d1dqml2
   part of anti-lysozyme Fab HYHEL-63

Details for d1dqmh1

PDB Entry: 1dqm, 2.1 Å

PDB Description: crystal structure of anti-lysozyme antibody

PDB Compounds: (H:) anti-lysozyme antibody hyhel-63 (heavy chain)

SCOPe Domain Sequences for d1dqmh1:

Sequence; same for both SEQRES and ATOM records:

>d1dqmh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
vqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyhp
slksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

Timeline for d1dqmh1:

• d1dqmh1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqmh1 appears in SCOPe 2.07