SCOP 1.69: Domain d1dqja1: 1dqj A:1-107

Lineage for d1dqja1 (1dqj A:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)

8. Domain d1dqja1: 1dqj A:1-107 [20424]
   Other proteins in same PDB: d1dqja2, d1dqjb1, d1dqjb2, d1dqjc_
   part of anti-lysozyme Fab HYHEL-63

Details for d1dqja1

PDB Entry: 1dqj, 2 Å

PDB Description: crystal structure of the anti-lysozyme antibody hyhel-63 complexed with hen egg white lysozyme

SCOP Domain Sequences for d1dqja1:

Sequence; same for both SEQRES and ATOM records:

>d1dqja1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1dqja1:

• d1dqja1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqja1 appears in SCOP 1.67
  
• d1dqja1 appears in SCOP 1.71
  
• d1dqja1 appears in the current release, SCOPe 2.08