Class g: Small proteins [56992] (90 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
Protein automated matches [190212] (2 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [225070] (2 PDB entries) |
Domain d2f42a2: 2f42 A:205-282 [204172] Other proteins in same PDB: d2f42a1 automated match to d2c2la2 complexed with cl |
PDB Entry: 2f42 (more details), 2.5 Å
SCOPe Domain Sequences for d2f42a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f42a2 g.44.1.2 (A:205-282) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} kreipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfdpvtrspltqdqlipn lamkevidafiqengwve
Timeline for d2f42a2: