SCOPe 2.08: Domain d2f42a2: 2f42 A:205-282

Lineage for d2f42a2 (2f42 A:205-282)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.2: U-box [90222] (5 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein automated matches [190212] (2 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [225070] (2 PDB entries)

8. Domain d2f42a2: 2f42 A:205-282 [204172]
   Other proteins in same PDB: d2f42a1
   automated match to d2c2la2
   complexed with cl

Details for d2f42a2

PDB Entry: 2f42, 2.5 Å

PDB Description: dimerization and U-box domains of Zebrafish C-terminal of HSP70 interacting protein

PDB Compounds: (A:) STIP1 homology and U-Box containing protein 1

SCOPe Domain Sequences for d2f42a2:

Sequence; same for both SEQRES and ATOM records:

>d2f42a2 g.44.1.2 (A:205-282) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kreipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfdpvtrspltqdqlipn
lamkevidafiqengwve

Timeline for d2f42a2:

• d2f42a2 first appeared in SCOPe 2.03
  
• d2f42a2 appears in SCOPe 2.07