SCOPe 2.08: Domain d2epfc1: 2epf C:4-153

Lineage for d2epfc1 (2epf C:4-153)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.0: automated matches [227200] (1 protein)
   not a true family

6. Protein automated matches [226929] (4 species)
   not a true protein

7. Species Pseudechis porphyriacus [TaxId:8671] [225219] (2 PDB entries)

8. Domain d2epfc1: 2epf C:4-153 [204136]
   Other proteins in same PDB: d2epfa2, d2epfb2, d2epfc2, d2epfd2
   automated match to d1rc9a1
   complexed with na, zn

Details for d2epfc1

PDB Entry: 2epf, 2.3 Å

PDB Description: Crystal Structure of Zinc-Bound Pseudecin From Pseudechis Porphyriacus

PDB Compounds: (C:) Pseudecin

SCOPe Domain Sequences for d2epfc1:

Sequence; same for both SEQRES and ATOM records:

>d2epfc1 d.111.1.0 (C:4-153) automated matches {Pseudechis porphyriacus [TaxId: 8671]}
nyqkeivdkhnalrrsvkptarnmlqmkwnshaaqnakrwadrctfahsppntrtvgklr
cgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwykshligcasa
kcssskylyvcqycpagnirgsiatpyksg

Timeline for d2epfc1:

• d2epfc1 first appeared in SCOPe 2.03
  
• d2epfc1 appears in SCOPe 2.07