Lineage for d1rc9a1 (1rc9 A:1-164)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.111: PR-1-like [55796] (1 superfamily)
alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342Superfamily d.111.1: PR-1-like [55797] (2 families) 
Family d.111.1.1: PR-1-like [55798] (5 proteins)
Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
Protein Cysteine-rich secretory protein (SteCRISP) [118079] (1 species) Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [118080] (1 PDB entry)
Uniprot P60623 13-233
Domain d1rc9a1: 1rc9 A:1-164 [111765]
Other proteins in same PDB: d1rc9a2
Details for d1rc9a1
PDB Entry: 1rc9 (more details), 1.6 Å
PDB Description: crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains
PDB Compounds: (A:) cysteine-rich secretory proteinSCOPe Domain Sequences for d1rc9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc9a1 d.111.1.1 (A:1-164) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]}
nvdfdsesprkpeiqneivdlhnslrrsvnptasnmlrmewypeaadnaerwayrciesh
ssyesrviegikcgeniymspypmkwtdiihawhdeykdfkygvgadppnavtghytqiv
wyksyrigcaaaycpsspysyffvcqycpagnfigktatpytsg
SCOPe Domain Coordinates for d1rc9a1:
Click to download the PDB-style file with coordinates for d1rc9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rc9a1:
- d1rc9a1 first appeared in SCOP 1.71
- d1rc9a1 appears in SCOPe 2.07
View in 3D
