Lineage for d2e37c1 (2e37 C:1-141)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581655Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
  8. 1581683Domain d2e37c1: 2e37 C:1-141 [204062]
    Other proteins in same PDB: d2e37a2, d2e37b2, d2e37c2, d2e37d2, d2e37e2, d2e37f2, d2e37g2, d2e37h2
    automated match to d1llda1
    complexed with nad, so4

Details for d2e37c1

PDB Entry: 2e37 (more details), 2.3 Å

PDB Description: Structure of TT0471 protein from Thermus thermophilus
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2e37c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e37c1 c.2.1.0 (C:1-141) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

SCOPe Domain Coordinates for d2e37c1:

Click to download the PDB-style file with coordinates for d2e37c1.
(The format of our PDB-style files is described here.)

Timeline for d2e37c1: