Lineage for d43cae_ (43ca E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511793Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (46 PDB entries)
  8. 1511829Domain d43cae_: 43ca E: [20398]
    Other proteins in same PDB: d43cab_, d43cad_, d43caf_, d43cah_
    part of sterolytic and amidolytic Fv 43c9
    complexed with npo

Details for d43cae_

PDB Entry: 43ca (more details), 2.3 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
PDB Compounds: (E:) protein (immunoglobulin (light chain))

SCOPe Domain Sequences for d43cae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43cae_ b.1.1.1 (E:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik

SCOPe Domain Coordinates for d43cae_:

Click to download the PDB-style file with coordinates for d43cae_.
(The format of our PDB-style files is described here.)

Timeline for d43cae_: