SCOPe 2.08: Domain d2ddad1: 2dda D:4-154

Lineage for d2ddad1 (2dda D:4-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.0: automated matches [227200] (1 protein)
   not a true family

6. Protein automated matches [226929] (4 species)
   not a true protein

7. Species Pseudechis australis [TaxId:8670] [225217] (1 PDB entry)

8. Domain d2ddad1: 2dda D:4-154 [203959]
   Other proteins in same PDB: d2ddaa2, d2ddab2, d2ddac2, d2ddad2
   automated match to d1rc9a1
   complexed with fmt, gol, na

Details for d2ddad1

PDB Entry: 2dda, 2.25 Å

PDB Description: Crystal structure of pseudechetoxin from Pseudechis australis

PDB Compounds: (D:) Pseudechetoxin

SCOPe Domain Sequences for d2ddad1:

Sequence; same for both SEQRES and ATOM records:

>d2ddad1 d.111.1.0 (D:4-154) automated matches {Pseudechis australis [TaxId: 8670]}
knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl
rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas
akcssskylyvcqycpagnirgsiatpyksg

Timeline for d2ddad1:

• d2ddad1 first appeared in SCOPe 2.03
  
• d2ddad1 appears in SCOPe 2.07