Lineage for d2d7ja_ (2d7j A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2117753Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2117899Protein automated matches [190743] (4 species)
    not a true protein
  7. 2117922Species Pyrococcus horikoshii OT3 [TaxId:70601] [225180] (1 PDB entry)
  8. 2117923Domain d2d7ja_: 2d7j A: [203940]
    automated match to d1wl8a1

Details for d2d7ja_

PDB Entry: 2d7j (more details), 1.89 Å

PDB Description: Crystal Structure Analysis of Glutamine Amidotransferase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit A

SCOPe Domain Sequences for d2d7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7ja_ c.23.16.1 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mivimdnggqyvhriwrtlrylgvetkiipnttpleeikamnpkgiifsggpslentgnc
ekvlehydefnvpilgiclghqliakffggkvgrgekaeyslveieiidedeifkglpkr
lkvweshmdevkelppkfkilarsetcpieamkheelpiygvqfhpevahtekgeeilrn
faklcgel

SCOPe Domain Coordinates for d2d7ja_:

Click to download the PDB-style file with coordinates for d2d7ja_.
(The format of our PDB-style files is described here.)

Timeline for d2d7ja_: