SCOPe 2.06: Domain d2d7ja_: 2d7j A:

Lineage for d2d7ja_ (2d7j A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein automated matches [190743] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [225180] (1 PDB entry)

8. Domain d2d7ja_: 2d7j A: [203940]
   automated match to d1wl8a1

Details for d2d7ja_

PDB Entry: 2d7j, 1.89 Å

PDB Description: Crystal Structure Analysis of Glutamine Amidotransferase from Pyrococcus horikoshii OT3

PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit A

SCOPe Domain Sequences for d2d7ja_:

Sequence; same for both SEQRES and ATOM records:

>d2d7ja_ c.23.16.1 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mivimdnggqyvhriwrtlrylgvetkiipnttpleeikamnpkgiifsggpslentgnc
ekvlehydefnvpilgiclghqliakffggkvgrgekaeyslveieiidedeifkglpkr
lkvweshmdevkelppkfkilarsetcpieamkheelpiygvqfhpevahtekgeeilrn
faklcgel

Timeline for d2d7ja_:

• d2d7ja_ first appeared in SCOPe 2.03
  
• d2d7ja_ appears in SCOPe 2.05
  
• d2d7ja_ appears in SCOPe 2.07
  
• d2d7ja_ appears in the current release, SCOPe 2.08