![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Cellulomonas sp. [TaxId:40001] [225172] (1 PDB entry) |
![]() | Domain d2d4wb2: 2d4w B:255-504 [203913] automated match to d3ezwd2 complexed with mpd |
PDB Entry: 2d4w (more details), 2.3 Å
SCOPe Domain Sequences for d2d4wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4wb2 c.55.1.0 (B:255-504) automated matches {Cellulomonas sp. [TaxId: 40001]} acfevgqakntygtgnflllntgtekvmskngllttvcykigdapavyalegsiavtgsl vqwlrdnlgmfedapdvewlagkvqdnggayfvpafsglfapywrpdargalvgltryvn rnhiaraaleatafqsrevvdamnadsgvdltelrvdggmvanellmqfqadqlgvdvvr pkvaettalgaayaagiavgfwkgeqdvidnwaedkrwspsmesgererlyrnwkkavtk tmewvdedve
Timeline for d2d4wb2: