SCOPe 2.03: Domain d2d4wb2: 2d4w B:255-504

Lineage for d2d4wb2 (2d4w B:255-504)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Cellulomonas sp. [TaxId:40001] [225172] (1 PDB entry)

8. Domain d2d4wb2: 2d4w B:255-504 [203913]
   automated match to d3ezwd2
   complexed with mpd

Details for d2d4wb2

PDB Entry: 2d4w, 2.3 Å

PDB Description: Crystal structure of glycerol kinase from Cellulomonas sp. NT3060

PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d2d4wb2:

Sequence; same for both SEQRES and ATOM records:

>d2d4wb2 c.55.1.0 (B:255-504) automated matches {Cellulomonas sp. [TaxId: 40001]}
acfevgqakntygtgnflllntgtekvmskngllttvcykigdapavyalegsiavtgsl
vqwlrdnlgmfedapdvewlagkvqdnggayfvpafsglfapywrpdargalvgltryvn
rnhiaraaleatafqsrevvdamnadsgvdltelrvdggmvanellmqfqadqlgvdvvr
pkvaettalgaayaagiavgfwkgeqdvidnwaedkrwspsmesgererlyrnwkkavtk
tmewvdedve

Timeline for d2d4wb2:

• d2d4wb2 is new in SCOPe 2.03-stable
  
• d2d4wb2 appears in SCOPe 2.04
  
• d2d4wb2 appears in the current release, SCOPe 2.08