Lineage for d2d3ma1 (2d3m A:4-248)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165223Species Aloe arborescens [TaxId:45385] [225155] (3 PDB entries)
  8. 2165232Domain d2d3ma1: 2d3m A:4-248 [203895]
    Other proteins in same PDB: d2d3ma3
    automated match to d1cmla1
    complexed with coa

Details for d2d3ma1

PDB Entry: 2d3m (more details), 1.6 Å

PDB Description: Pentaketide chromone synthase complexed with coenzyme A
PDB Compounds: (A:) pentaketide chromone synthase

SCOPe Domain Sequences for d2d3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3ma1 c.95.1.0 (A:4-248) automated matches {Aloe arborescens [TaxId: 45385]}
msslsnslplmedvqgirkaqkadgtatvmaigtahpphifpqdtyadvyfratnsehkv
elkkkfdhickktmigkryfnydeeflkkypnitsydepslndrqdicvpgvpalgteaa
vkaieewgrpkseithlvfctscgvdmpsadfqcakllglhanvnkyciymqgcyaggtv
mryakdlaennrgarvlvvcaeltimmlrapnethldnaigislfgdgaaaliigsdpii
gvekp

SCOPe Domain Coordinates for d2d3ma1:

Click to download the PDB-style file with coordinates for d2d3ma1.
(The format of our PDB-style files is described here.)

Timeline for d2d3ma1: