SCOPe 2.08: Domain d43c9c_: 43c9 C:

Lineage for d43c9c_ (43c9 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)

8. Domain d43c9c_: 43c9 C: [20388]
   Other proteins in same PDB: d43c9b_, d43c9d_, d43c9f_, d43c9h_
   part of sterolytic and amidolytic Fv 43c9

Details for d43c9c_

PDB Entry: 43c9, 2.2 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody

PDB Compounds: (C:) protein (immunoglobulin (light chain))

SCOPe Domain Sequences for d43c9c_:

Sequence; same for both SEQRES and ATOM records:

>d43c9c_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
dvvmtqtpsslamsvgqkvtmsckssqsllnisnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedqadyfcqqhyraprtfgggtkleik

Timeline for d43c9c_:

• d43c9c_ first appeared (with stable ids) in SCOP 1.55
  
• d43c9c_ appears in SCOPe 2.07