SCOPe 2.08: Domain d2d23a2: 2d23 A:322-436

Lineage for d2d23a2 (2d23 A:322-436)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (7 PDB entries)

8. Domain d2d23a2: 2d23 A:322-436 [203874]
   Other proteins in same PDB: d2d23a1, d2d23b1
   automated match to d1xyfa1
   complexed with azi, gol; mutant

Details for d2d23a2

PDB Entry: 2d23, 1.95 Å

PDB Description: crystal structure of ep complex of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86

PDB Compounds: (A:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d23a2:

Sequence; same for both SEQRES and ATOM records:

>d2d23a2 b.42.2.0 (A:322-436) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
rcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtgngtkvqiys
cwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqrwtrt

Timeline for d2d23a2:

• d2d23a2 first appeared in SCOPe 2.03
  
• d2d23a2 appears in SCOPe 2.07