Lineage for d2d22b2 (2d22 B:822-936)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543626Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1543627Protein automated matches [226913] (8 species)
    not a true protein
  7. 1543681Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (5 PDB entries)
  8. 1543685Domain d2d22b2: 2d22 B:822-936 [203872]
    Other proteins in same PDB: d2d22a1, d2d22b1
    automated match to d1xyfa1
    complexed with gol, so4; mutant

Details for d2d22b2

PDB Entry: 2d22 (more details), 1.7 Å

PDB Description: crystal structure of covalent glycosyl-enzyme intermediate of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86
PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d22b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d22b2 b.42.2.0 (B:822-936) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
rcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtgngtkvqiys
cwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqrwtrt

SCOPe Domain Coordinates for d2d22b2:

Click to download the PDB-style file with coordinates for d2d22b2.
(The format of our PDB-style files is described here.)

Timeline for d2d22b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d22b1