Lineage for d43c9b_ (43c9 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52759Species Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain [48883] (2 PDB entries)
  8. 52761Domain d43c9b_: 43c9 B: [20387]

Details for d43c9b_

PDB Entry: 43c9 (more details), 2.2 Å

PDB Description: crystallographic structure of the esterolytic and amidolytic 43c9 antibody

SCOP Domain Sequences for d43c9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d43c9b_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Sterolytic and amidolytic Fv 43c9, (mouse), kappa L chain}
gqvqlvesgpglvapsqslsitctvsgislsrynvhwvrqspgkglewlgmiwgggsiey
npalksrlsiskdnsksqiflkmnslqtddsamyycvsygyggdrfsywgqgtlvtvs

SCOP Domain Coordinates for d43c9b_:

Click to download the PDB-style file with coordinates for d43c9b_.
(The format of our PDB-style files is described here.)

Timeline for d43c9b_: