Lineage for d2d20b1 (2d20 B:501-801)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819412Protein automated matches [190057] (21 species)
    not a true protein
  7. 1819488Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (8 PDB entries)
  8. 1819496Domain d2d20b1: 2d20 B:501-801 [203867]
    Other proteins in same PDB: d2d20a2, d2d20b2
    automated match to d1xyfa2
    complexed with gol, npo; mutant

Details for d2d20b1

PDB Entry: 2d20 (more details), 1.85 Å

PDB Description: crystal structure of michaelis complex of catalytic-site mutant xylanase from streptomyces olivaceoviridis e-86
PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d2d20b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d20b1 c.1.8.3 (B:501-801) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
n

SCOPe Domain Coordinates for d2d20b1:

Click to download the PDB-style file with coordinates for d2d20b1.
(The format of our PDB-style files is described here.)

Timeline for d2d20b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d20b2