SCOPe 2.08: Domain d2cz9a2: 2cz9 A:179-350

Lineage for d2cz9a2 (2cz9 A:179-350)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.0: automated matches [227186] (1 protein)
   not a true family

6. Protein automated matches [226908] (6 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [225135] (3 PDB entries)

8. Domain d2cz9a2: 2cz9 A:179-350 [203853]
   Other proteins in same PDB: d2cz9a1
   automated match to d1s4ed2
   complexed with cl, gol

Details for d2cz9a2

PDB Entry: 2cz9, 1.5 Å

PDB Description: Crystal Structure of galactokinase from Pyrococcus horikoshi

PDB Compounds: (A:) Probable galactokinase

SCOPe Domain Sequences for d2cz9a2:

Sequence, based on SEQRES records:

>d2cz9a2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dvsilvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgy
ivrenarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgayga
rltgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi

Sequence, based on observed residues (ATOM records):

>d2cz9a2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dvsilvfytgvrsseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyivre
narvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarltg
agfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi

Timeline for d2cz9a2:

• d2cz9a2 first appeared in SCOPe 2.03
  
• d2cz9a2 appears in SCOPe 2.07