![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.26.0: automated matches [227186] (1 protein) not a true family |
![]() | Protein automated matches [226908] (5 species) not a true protein |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [225135] (3 PDB entries) |
![]() | Domain d2cz9a2: 2cz9 A:179-350 [203853] Other proteins in same PDB: d2cz9a1 automated match to d1s4ed2 complexed with cl, gol |
PDB Entry: 2cz9 (more details), 1.5 Å
SCOPe Domain Sequences for d2cz9a2:
Sequence, based on SEQRES records: (download)
>d2cz9a2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]} dvsilvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgy ivrenarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgayga rltgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi
>d2cz9a2 d.58.26.0 (A:179-350) automated matches {Pyrococcus horikoshii [TaxId: 53953]} dvsilvfytgvrsseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyivre narvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarltg agfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi
Timeline for d2cz9a2: