Lineage for d2dlfh_ (2dlf H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2352940Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2352946Domain d2dlfh_: 2dlf H: [20385]
    Other proteins in same PDB: d2dlfl_
    part of anti-dansyl Fv
    complexed with so4

Details for d2dlfh_

PDB Entry: 2dlf (more details), 1.55 Å

PDB Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 6.75
PDB Compounds: (H:) protein (anti-dansyl immunoglobulin igg2a(s) (heavy chain))

SCOPe Domain Sequences for d2dlfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs

SCOPe Domain Coordinates for d2dlfh_:

Click to download the PDB-style file with coordinates for d2dlfh_.
(The format of our PDB-style files is described here.)

Timeline for d2dlfh_: