Lineage for d2cv6a1 (2cv6 A:7-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424741Species Mung bean (Vigna radiata) [TaxId:157791] [225082] (1 PDB entry)
  8. 2424742Domain d2cv6a1: 2cv6 A:7-213 [203832]
    automated match to d1uika1

Details for d2cv6a1

PDB Entry: 2cv6 (more details), 2.65 Å

PDB Description: Crystal Structure of 8Salpha Globulin, the Major Seed Storage Protein of Mungbean
PDB Compounds: (A:) Seed storage protein

SCOPe Domain Sequences for d2cv6a1:

Sequence, based on SEQRES records: (download)

>d2cv6a1 b.82.1.0 (A:7-213) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]}
svsrgknnpfyfnsdrwfhtlfrnqfghlrvlqrfdqrskqmqnlenyrvvefnskpntl
llphhadadfllvvlngravltlvnpdgrdsnileqghaqkipagttfflvnpddeenlr
iiklavpvnnphrfqdfflssteaqqsylqgfsknileasfdsdikeisrvlfgeegqqq
qqgqesqqegvivelkreqireltkha

Sequence, based on observed residues (ATOM records): (download)

>d2cv6a1 b.82.1.0 (A:7-213) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]}
svsrgknnpfyfnsdrwfhtlfrnqfghlrvlqrfdqrskqmqnlenyrvvefnskpntl
llphhadadfllvvlngravltlvnpdgrdsnileqghaqkipagttfflvnpddeenlr
iiklavpvnnphrfqdfflssteaqqsylqgfsknileasfdsdikeisrvlfgsqqegv
ivelkreqireltkha

SCOPe Domain Coordinates for d2cv6a1:

Click to download the PDB-style file with coordinates for d2cv6a1.
(The format of our PDB-style files is described here.)

Timeline for d2cv6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cv6a2