Lineage for d2chxa2 (2chx A:357-522)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382507Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2382530Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2382531Species Human (Homo sapiens) [TaxId:9606] [49572] (70 PDB entries)
  8. 2382547Domain d2chxa2: 2chx A:357-522 [203792]
    Other proteins in same PDB: d2chxa1, d2chxa3, d2chxa4
    automated match to d1e8ya2
    complexed with 090

Details for d2chxa2

PDB Entry: 2chx (more details), 2.5 Å

PDB Description: a pharmacological map of the pi3-k family defines a role for p110alpha in signaling: the structure of complex of phosphoinositide 3-kinase gamma with inhibitor pik-90
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d2chxa2:

Sequence, based on SEQRES records: (download)

>d2chxa2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d2chxa2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycrllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsat
npdkensmsisilldn

SCOPe Domain Coordinates for d2chxa2:

Click to download the PDB-style file with coordinates for d2chxa2.
(The format of our PDB-style files is described here.)

Timeline for d2chxa2: