Lineage for d2chwa2 (2chw A:357-522)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045102Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2045125Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2045126Species Human (Homo sapiens) [TaxId:9606] [49572] (61 PDB entries)
  8. 2045156Domain d2chwa2: 2chw A:357-522 [203788]
    Other proteins in same PDB: d2chwa1, d2chwa3, d2chwa4
    automated match to d1e8ya2
    complexed with 039

Details for d2chwa2

PDB Entry: 2chw (more details), 2.6 Å

PDB Description: a pharmacological map of the pi3-k family defines a role for p110 alpha in signaling: the structure of complex of phosphoinositide 3- kinase gamma with inhibitor pik-39
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d2chwa2:

Sequence, based on SEQRES records: (download)

>d2chwa2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d2chwa2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn
pdkensmsisilldn

SCOPe Domain Coordinates for d2chwa2:

Click to download the PDB-style file with coordinates for d2chwa2.
(The format of our PDB-style files is described here.)

Timeline for d2chwa2: