Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein automated matches [226880] (4 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [225053] (2 PDB entries) |
Domain d2cdyc2: 2cdy C:99-210 [203775] Other proteins in same PDB: d2cdya1, d2cdyb1, d2cdyc1, d2cdyd1 automated match to d1y67a2 complexed with mn |
PDB Entry: 2cdy (more details), 2 Å
SCOPe Domain Sequences for d2cdyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdyc2 d.44.1.1 (C:99-210) automated matches {Deinococcus radiodurans [TaxId: 243230]} psgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmge aiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
Timeline for d2cdyc2: