Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225003] (11 PDB entries) |
Domain d2c3qd2: 2c3q D:80-240 [203731] Other proteins in same PDB: d2c3qa1, d2c3qb1, d2c3qc1, d2c3qd1 automated match to d2ljra1 complexed with gtx, iod; mutant |
PDB Entry: 2c3q (more details), 1.85 Å
SCOPe Domain Sequences for d2c3qd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3qd2 a.45.1.0 (D:80-240) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpdywypqdlqararvdeylawqhttlrrsclralwhkvmfpvflgepvspqtlaatlae ldvtlqlledkflqnkafltgphisladlvaitelmhpvgagcqvfegrpklatwrqrve aavgedlfqeahevilkakdfppadptikqklmprvlamir
Timeline for d2c3qd2: