SCOPe 2.04: Domain d2c0tb2: 2c0t B:121-223

Lineage for d2c0tb2 (2c0t B:121-223)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (18 PDB entries)

8. Domain d2c0tb2: 2c0t B:121-223 [203680]
   Other proteins in same PDB: d2c0ta1, d2c0ta3, d2c0tb1, d2c0tb3
   automated match to d1qcfa2
   complexed with ca, l3g

Details for d2c0tb2

PDB Entry: 2c0t, 2.15 Å

PDB Description: src family kinase hck with bound inhibitor a-641359

PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d2c0tb2:

Sequence, based on SEQRES records:

>d2c0tb2 d.93.1.1 (B:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Sequence, based on observed residues (ATOM records):

>d2c0tb2 d.93.1.1 (B:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tgfyisprstfstlqelvdhykkgndglcqklsvpcmss

Timeline for d2c0tb2:

• d2c0tb2 first appeared in SCOPe 2.03
  
• d2c0tb2 appears in SCOPe 2.05
  
• d2c0tb2 appears in the current release, SCOPe 2.08