Lineage for d2c0ta3 (2c0t A:224-505)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981671Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2981672Species Human (Homo sapiens) [TaxId:9606] [56152] (25 PDB entries)
  8. 2981696Domain d2c0ta3: 2c0t A:224-505 [203678]
    Other proteins in same PDB: d2c0ta1, d2c0ta2, d2c0ta4, d2c0tb1, d2c0tb2, d2c0tb4
    automated match to d1qcfa3
    complexed with ca, l3g

Details for d2c0ta3

PDB Entry: 2c0t (more details), 2.15 Å

PDB Description: src family kinase hck with bound inhibitor a-641359
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d2c0ta3:

Sequence, based on SEQRES records: (download)

>d2c0ta3 d.144.1.7 (A:224-505) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records): (download)

>d2c0ta3 d.144.1.7 (A:224-505) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftik
sdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknr
peerptfeyiqsvlddfytatesqyeeip

SCOPe Domain Coordinates for d2c0ta3:

Click to download the PDB-style file with coordinates for d2c0ta3.
(The format of our PDB-style files is described here.)

Timeline for d2c0ta3: