Lineage for d2btua2 (2btu A:168-341)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584675Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2584676Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2584750Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2584751Protein automated matches [226902] (12 species)
    not a true protein
  7. 2584764Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225123] (1 PDB entry)
  8. 2584765Domain d2btua2: 2btu A:168-341 [203635]
    Other proteins in same PDB: d2btua1, d2btub1
    automated match to d1clia2

Details for d2btua2

PDB Entry: 2btu (more details), 2.31 Å

PDB Description: crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.
PDB Compounds: (A:) phosphoribosyl-aminoimidazole synthetase

SCOPe Domain Sequences for d2btua2:

Sequence, based on SEQRES records: (download)

>d2btua2 d.139.1.0 (A:168-341) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
tgekieaghvliglassgihsngyslvrkvlledgelsldriygrlelplgeellkptki
yvkpilellknhevygmahitgggfieniprmlpegigaeielgswkiqpifsllqevgk
leekemfnifnmgigmvvavkeedakdivrlleeqgetariigrtvqgagvtfn

Sequence, based on observed residues (ATOM records): (download)

>d2btua2 d.139.1.0 (A:168-341) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
tgekieaghvliglassgihsngyslvrkvlledgeliygrlelplgeellkptkiyvkp
ilellknhevygmahitgggfieniprmlpegigaeielgswkiqpifsllqevgkleek
emfnifnmgigmvvavkeedakdivrlleeqgetariigrtvqgagvtfn

SCOPe Domain Coordinates for d2btua2:

Click to download the PDB-style file with coordinates for d2btua2.
(The format of our PDB-style files is described here.)

Timeline for d2btua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2btua1