Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries) |
Domain d2bgjc1: 2bgj C:16-113 [203600] Other proteins in same PDB: d2bgja2, d2bgjb2, d2bgjc2, d2bgjd2 automated match to d1a8pa1 complexed with fad |
PDB Entry: 2bgj (more details), 2.1 Å
SCOPe Domain Sequences for d2bgjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgjc1 b.43.4.0 (C:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]} pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv
Timeline for d2bgjc1: