Lineage for d2bgjc1 (2bgj C:16-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403245Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2403246Protein automated matches [226870] (22 species)
    not a true protein
  7. 2403351Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries)
  8. 2403361Domain d2bgjc1: 2bgj C:16-113 [203600]
    Other proteins in same PDB: d2bgja2, d2bgjb2, d2bgjc2, d2bgjd2
    automated match to d1a8pa1
    complexed with fad

Details for d2bgjc1

PDB Entry: 2bgj (more details), 2.1 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus at 2.1 angstroms
PDB Compounds: (C:) ferredoxin-nadp(h) reductase

SCOPe Domain Sequences for d2bgjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgjc1 b.43.4.0 (C:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde
elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv

SCOPe Domain Coordinates for d2bgjc1:

Click to download the PDB-style file with coordinates for d2bgjc1.
(The format of our PDB-style files is described here.)

Timeline for d2bgjc1: