SCOP 1.59: Domain d1mnul1: 1mnu L:1-112

Lineage for d1mnul1 (1mnu L:1-112)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Bactericidal Fab MN12H2, (mouse), kappa L chain [48874] (3 PDB entries)

8. Domain d1mnul1: 1mnu L:1-112 [20358]
   Other proteins in same PDB: d1mnuh2, d1mnul2

Details for d1mnul1

PDB Entry: 1mnu, 2.5 Å

PDB Description: unliganded bactericidal antibody against neisseria meningitidis

SCOP Domain Sequences for d1mnul1:

Sequence; same for both SEQRES and ATOM records:

>d1mnul1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Bactericidal Fab MN12H2, (mouse), kappa L chain}
divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleik

Timeline for d1mnul1:

• d1mnul1 first appeared (with stable ids) in SCOP 1.55
  
• d1mnul1 appears in SCOP 1.57
  
• d1mnul1 appears in SCOP 1.61
  
• d1mnul1 appears in the current release, SCOPe 2.08