SCOPe 2.06: Domain d2b7pc1: 2b7p C:1-102

Lineage for d2b7pc1 (2b7p C:1-102)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (8 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [225050] (2 PDB entries)

8. Domain d2b7pc1: 2b7p C:1-102 [203571]
   Other proteins in same PDB: d2b7pa2, d2b7pb2, d2b7pc2
   automated match to d1qapa2
   complexed with pht, so4

Details for d2b7pc1

PDB Entry: 2b7p, 2.51 Å

PDB Description: crystal structure of quinolinic acid phosphoribosyltransferase from helicobacter pylori with phthalic acid

PDB Compounds: (C:) Probable nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d2b7pc1:

Sequence; same for both SEQRES and ATOM records:

>d2b7pc1 d.41.2.0 (C:1-102) automated matches {Helicobacter pylori [TaxId: 210]}
meirtfleralkedlghgdlfervlekdfkatafvrakqegvfsgekyalellemtgiec
vqtikdkerfkpkdalmeirgdfsmllkvertllnllqhssg

Timeline for d2b7pc1:

• d2b7pc1 first appeared in SCOPe 2.03
  
• d2b7pc1 appears in SCOPe 2.05
  
• d2b7pc1 appears in SCOPe 2.07
  
• d2b7pc1 appears in the current release, SCOPe 2.08