SCOPe 2.08: Domain d2b1ma_: 2b1m A:

Lineage for d2b1ma_ (2b1m A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Pachyrhizus erosus [TaxId:109171] [225133] (1 PDB entry)

8. Domain d2b1ma_: 2b1m A: [203539]
   automated match to d1s4vb_
   complexed with peg, pg4

Details for d2b1ma_

PDB Entry: 2b1m, 2 Å

PDB Description: crystal structure of a papain-fold protein without the catalytic cysteine from seeds of pachyrhizus erosus

PDB Compounds: (A:) spe31

SCOPe Domain Sequences for d2b1ma_:

Sequence; same for both SEQRES and ATOM records:

>d2b1ma_ d.3.1.0 (A:) automated matches {Pachyrhizus erosus [TaxId: 109171]}
apeswdwskkgvitkvkfqgqcgsgwafsatgaieaahaiatgnlvslseqelidcvdes
egcyngwhyqsfewvvkhggiaseadypykardgkckaneiqdkvtidnygvqilsnest
eseaesslqsfvleqpisvsidakdfhfysggiydggncsspyginhfvlivgygsedgv
dywiaknswgedwgidgyiriqrntgnllgvcgmnyfasypiiek

Timeline for d2b1ma_:

• d2b1ma_ first appeared in SCOPe 2.03
  
• d2b1ma_ appears in SCOPe 2.07