Lineage for d2avfd2 (2avf D:160-324)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2381960Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)
  8. 2381982Domain d2avfd2: 2avf D:160-324 [203493]
    automated match to d1bq5a2
    complexed with cl, cu

Details for d2avfd2

PDB Entry: 2avf (more details), 2.6 Å

PDB Description: Crystal Structure of C-terminal Desundecapeptide Nitrite Reductase from Achromobacter cycloclastes
PDB Compounds: (D:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2avfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avfd2 b.6.1.0 (D:160-324) automated matches {Achromobacter cycloclastes [TaxId: 223]}
dglkdekgqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthiv
fngavgaltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqe
twlipggtagaafytfrqpgvyayvnhnlieafelgaaghfkvtg

SCOPe Domain Coordinates for d2avfd2:

Click to download the PDB-style file with coordinates for d2avfd2.
(The format of our PDB-style files is described here.)

Timeline for d2avfd2: