Lineage for d2aexa_ (2aex A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008710Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 3008711Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (2 families) (S)
    automatically mapped to Pfam PF01218
  5. 3008747Family d.248.1.0: automated matches [227158] (1 protein)
    not a true family
  6. 3008748Protein automated matches [226865] (1 species)
    not a true protein
  7. 3008749Species Human (Homo sapiens) [TaxId:9606] [224998] (1 PDB entry)
  8. 3008750Domain d2aexa_: 2aex A: [203444]
    automated match to d1tlba_
    complexed with cit

Details for d2aexa_

PDB Entry: 2aex (more details), 1.58 Å

PDB Description: The 1.58A Crystal Structure of Human Coproporphyrinogen Oxidase Reveals the Structural Basis of Hereditary Coproporphyria
PDB Compounds: (A:) Coproporphyrinogen III oxidase, mitochondrial

SCOPe Domain Sequences for d2aexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aexa_ d.248.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedelahrcssfmappvtdlgelrrrpgdmktkmelliletqaqvcqalaqvdgganfsv
drwerkeggggiscvlqdgcvfekagvsisvvhgnlseeaakqmrsrgkvlktkdgklpf
camgvssvihpknphaptihfnyryfeveeadgnkqwwfgggcdltptylnqedavhfhr
tlkeacdqhgpdlypkfkkwcddyffiahrgerrgiggiffddldspskeevfrfvqsca
ravvpsyiplvkkhcddsftpqeklwqqlrrgryvefnllydrgtkfglftpgsriesil
mslpltarweymhspsenskeaeilevlrhprdwvr

SCOPe Domain Coordinates for d2aexa_:

Click to download the PDB-style file with coordinates for d2aexa_.
(The format of our PDB-style files is described here.)

Timeline for d2aexa_: