Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies) alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567 |
Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (2 families) automatically mapped to Pfam PF01218 |
Family d.248.1.0: automated matches [227158] (1 protein) not a true family |
Protein automated matches [226865] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224998] (1 PDB entry) |
Domain d2aexa_: 2aex A: [203444] automated match to d1tlba_ complexed with cit |
PDB Entry: 2aex (more details), 1.58 Å
SCOPe Domain Sequences for d2aexa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aexa_ d.248.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eedelahrcssfmappvtdlgelrrrpgdmktkmelliletqaqvcqalaqvdgganfsv drwerkeggggiscvlqdgcvfekagvsisvvhgnlseeaakqmrsrgkvlktkdgklpf camgvssvihpknphaptihfnyryfeveeadgnkqwwfgggcdltptylnqedavhfhr tlkeacdqhgpdlypkfkkwcddyffiahrgerrgiggiffddldspskeevfrfvqsca ravvpsyiplvkkhcddsftpqeklwqqlrrgryvefnllydrgtkfglftpgsriesil mslpltarweymhspsenskeaeilevlrhprdwvr
Timeline for d2aexa_: