PDB entry 2aex

View 2aex on RCSB PDB site
Description: The 1.58A Crystal Structure of Human Coproporphyrinogen Oxidase Reveals the Structural Basis of Hereditary Coproporphyria
Class: Oxidoreductase
Keywords: flat beta-sheet sandwiched by helices, Oxidoreductase
Deposited on 2005-07-24, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.187
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coproporphyrinogen III oxidase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CPOX, CPO, CPX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aexa_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aexA (A:)
    gstslgrpeeeedelahrcssfmappvtdlgelrrrpgdmktkmelliletqaqvcqala
    qvdgganfsvdrwerkeggggiscvlqdgcvfekagvsisvvhgnlseeaakqmrsrgkv
    lktkdgklpfcamgvssvihpknphaptihfnyryfeveeadgnkqwwfgggcdltptyl
    nqedavhfhrtlkeacdqhgpdlypkfkkwcddyffiahrgerrgiggiffddldspske
    evfrfvqscaravvpsyiplvkkhcddsftpqeklwqqlrrgryvefnllydrgtkfglf
    tpgsriesilmslpltarweymhspsenskeaeilevlrhprdwvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aexA (A:)
    eedelahrcssfmappvtdlgelrrrpgdmktkmelliletqaqvcqalaqvdgganfsv
    drwerkeggggiscvlqdgcvfekagvsisvvhgnlseeaakqmrsrgkvlktkdgklpf
    camgvssvihpknphaptihfnyryfeveeadgnkqwwfgggcdltptylnqedavhfhr
    tlkeacdqhgpdlypkfkkwcddyffiahrgerrgiggiffddldspskeevfrfvqsca
    ravvpsyiplvkkhcddsftpqeklwqqlrrgryvefnllydrgtkfglftpgsriesil
    mslpltarweymhspsenskeaeilevlrhprdwvr