Lineage for d2aa3b2 (2aa3 B:164-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232756Species Plasmodium vivax [TaxId:5855] [225044] (3 PDB entries)
  8. 2232763Domain d2aa3b2: 2aa3 B:164-329 [203425]
    Other proteins in same PDB: d2aa3a1, d2aa3a3, d2aa3b1, d2aa3c1, d2aa3c3, d2aa3d1
    automated match to d1t26a2
    complexed with ap0, so4

Details for d2aa3b2

PDB Entry: 2aa3 (more details), 2.05 Å

PDB Description: crystal structure of plasmodium vivax lactate dehydrogenase complex with apadh
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2aa3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aa3b2 d.162.1.1 (B:164-329) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkali

SCOPe Domain Coordinates for d2aa3b2:

Click to download the PDB-style file with coordinates for d2aa3b2.
(The format of our PDB-style files is described here.)

Timeline for d2aa3b2: