SCOPe 2.07: Domain d2a8ba1: 2a8b A:375-655

Lineage for d2a8ba1 (2a8b A:375-655)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d2a8ba1: 2a8b A:375-655 [203401]
   Other proteins in same PDB: d2a8ba2
   automated match to d1yfoa_
   complexed with cl

Details for d2a8ba1

PDB Entry: 2a8b, 2.3 Å

PDB Description: Crystal Structure of the Catalytic Domain of Human Tyrosine Phosphatase Receptor, Type R

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase R

SCOPe Domain Sequences for d2a8ba1:

Sequence; same for both SEQRES and ATOM records:

>d2a8ba1 c.45.1.0 (A:375-655) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sriltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtknryktilpnplsrvcl
rpknvtdslstyinanyirgysgkekafiatqgpmintvddfwqmvwqedspvivmitkl
keknekcvlywpekrgiygkvevlvisvnecdnytirnlvlkqgshtqhvkhywytswpd
hktpdsaqpllqlmldveedrlasqgrgpvvvhcsagigrtgcfiatsigcqqlkeegvv
dalsivcqlrmdrggmvqtseqyefvhhalclyesrlsaet

Timeline for d2a8ba1:

• d2a8ba1 first appeared in SCOPe 2.03, called d2a8ba_
  
• d2a8ba1 appears in SCOPe 2.06
  
• d2a8ba1 appears in the current release, SCOPe 2.08