Lineage for d1z5va2 (1z5v A:247-440)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201804Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2201805Protein automated matches [226843] (8 species)
    not a true protein
  7. 2201823Species Human (Homo sapiens) [TaxId:9606] [224983] (3 PDB entries)
  8. 2201826Domain d1z5va2: 1z5v A:247-440 [203302]
    Other proteins in same PDB: d1z5va1
    automated match to d1jffb2
    complexed with gsp, mg

Details for d1z5va2

PDB Entry: 1z5v (more details), 2.71 Å

PDB Description: Crystal structure of human gamma-tubulin bound to GTPgammaS
PDB Compounds: (A:) Tubulin gamma-1 chain

SCOPe Domain Sequences for d1z5va2:

Sequence, based on SEQRES records: (download)

>d1z5va2 d.79.2.0 (A:247-440) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqpknvmvs
tgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspy
lpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsre
ivqqlideyhaatr

Sequence, based on observed residues (ATOM records): (download)

>d1z5va2 d.79.2.0 (A:247-440) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytplttdqsvrkttvldvmrrllqpknvmvstgt
nhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspylrvsglm
manhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlideyha
atr

SCOPe Domain Coordinates for d1z5va2:

Click to download the PDB-style file with coordinates for d1z5va2.
(The format of our PDB-style files is described here.)

Timeline for d1z5va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z5va1