SCOPe 2.03: Domain d1z4sc_: 1z4s C:

Lineage for d1z4sc_ (1z4s C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (78 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1z4sc_: 1z4s C: [203299]
   automated match to d1q03a_
   complexed with so4; mutant

Details for d1z4sc_

PDB Entry: 1z4s, 2.6 Å

PDB Description: Crystal Structure of Gly19 and Glu60 deletion mutant of Human Acidic Fibroblast Growth Factor

PDB Compounds: (C:) heparin-binding growth factor 1

SCOPe Domain Sequences for d1z4sc_:

Sequence; same for both SEQRES and ATOM records:

>d1z4sc_ b.42.1.1 (C:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
ksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
krgprthygqkailflplpv

Timeline for d1z4sc_:

• d1z4sc_ is new in SCOPe 2.03-stable
  
• d1z4sc_ appears in SCOPe 2.04
  
• d1z4sc_ appears in the current release, SCOPe 2.08, called d1z4sc1