Lineage for d1q03a_ (1q03 A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetrySuperfamily b.42.1: Cytokine [50353] (3 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) Protein Acidic FGF (FGF1) [50357] (4 species) Species Human (Homo sapiens) [TaxId:9606] [50359] (78 PDB entries)
Uniprot P05230 16-152 ! Uniprot P05230
Domain d1q03a_: 1q03 A: [104400]
mutant
Details for d1q03a_
PDB Entry: 1q03 (more details), 2.05 Å
PDB Description: crystal structure of fgf-1, s50g/v51g mutant
PDB Compounds: (A:) heparin-binding growth factor 1SCOPe Domain Sequences for d1q03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q03a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegggevyik
stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
krgprthygqkailflplpvs
SCOPe Domain Coordinates for d1q03a_:
Click to download the PDB-style file with coordinates for d1q03a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q03a_:
- d1q03a_ first appeared in SCOP 1.69
- d1q03a_ appears in SCOPe 2.02
- d1q03a_ appears in SCOPe 2.04
- d1q03a_ appears in the current release, SCOPe 2.08
View in 3D
