Lineage for d1yjea_ (1yje A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009659Species Norway rat (Rattus norvegicus) [TaxId:10116] [187147] (4 PDB entries)
  8. 2009663Domain d1yjea_: 1yje A: [203200]
    automated match to d3v3ea_

Details for d1yjea_

PDB Entry: 1yje (more details), 2.4 Å

PDB Description: crystal structure of the rngfi-b ligand-binding domain
PDB Compounds: (A:) Orphan nuclear receptor NR4A1

SCOPe Domain Sequences for d1yjea_:

Sequence, based on SEQRES records: (download)

>d1yjea_ a.123.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlltslirahldsgpntakldyskfqelvlprfgkedagdvqqfydllsgsldvirkwae
kipgfielspgdqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdw
idnilafsrslhslgvdvpafaclsalvlitdrhglqdprrveelqnriasclkehmaav
agdpqpasclsrllgklpelrtlctqglqrifclkledlvppppivdkifmdt

Sequence, based on observed residues (ATOM records): (download)

>d1yjea_ a.123.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlltslirahldsgpntakldyskfqelvlprfgkedagdvqqfydllsgsldvirkwae
kipgfielspgdqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdw
idnilafsrslhslgvdvpafaclsalvlitdrhglqdprrveelqnriasclkehmaav
sclsrllgklpelrtlctqglqrifclkledlvppppivdkifmdt

SCOPe Domain Coordinates for d1yjea_:

Click to download the PDB-style file with coordinates for d1yjea_.
(The format of our PDB-style files is described here.)

Timeline for d1yjea_: