Lineage for d1x1oa1 (1x1o A:10-116)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647148Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) (S)
  5. 1647220Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 1647221Protein automated matches [226878] (6 species)
    not a true protein
  7. 1647237Species Thermus thermophilus HB8 [TaxId:300852] [225062] (1 PDB entry)
  8. 1647238Domain d1x1oa1: 1x1o A:10-116 [203071]
    Other proteins in same PDB: d1x1oa2, d1x1ob2, d1x1oc2
    automated match to d1qapa2

Details for d1x1oa1

PDB Entry: 1x1o (more details), 1.9 Å

PDB Description: Crystal structure of project ID TT0268 from Thermus thermophilus HB8
PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d1x1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1oa1 d.41.2.0 (A:10-116) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
wqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwvaervfalad
prtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsg

SCOPe Domain Coordinates for d1x1oa1:

Click to download the PDB-style file with coordinates for d1x1oa1.
(The format of our PDB-style files is described here.)

Timeline for d1x1oa1: