Class b: All beta proteins [48724] (174 folds) |
Fold b.124: HesB-like domain [89359] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.124.1: HesB-like domain [89360] (2 families) |
Family b.124.1.0: automated matches [227171] (1 protein) not a true family |
Protein automated matches [226886] (1 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [225076] (1 PDB entry) |
Domain d1x0gc_: 1x0g C: [203051] automated match to d1nwba_ complexed with fes, na |
PDB Entry: 1x0g (more details), 2.5 Å
SCOPe Domain Sequences for d1x0gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0gc_ b.124.1.0 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsr
Timeline for d1x0gc_: