Lineage for d1x0gc_ (1x0g C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1335844Fold b.124: HesB-like domain [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1335845Superfamily b.124.1: HesB-like domain [89360] (2 families) (S)
  5. 1335861Family b.124.1.0: automated matches [227171] (1 protein)
    not a true family
  6. 1335862Protein automated matches [226886] (1 species)
    not a true protein
  7. 1335863Species Thermosynechococcus elongatus [TaxId:197221] [225076] (1 PDB entry)
  8. 1335866Domain d1x0gc_: 1x0g C: [203051]
    automated match to d1nwba_
    complexed with fes, na

Details for d1x0gc_

PDB Entry: 1x0g (more details), 2.5 Å

PDB Description: Crystal Structure of IscA with the [2Fe-2S] cluster
PDB Compounds: (C:) IscA

SCOPe Domain Sequences for d1x0gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0gc_ b.124.1.0 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvsr

SCOPe Domain Coordinates for d1x0gc_:

Click to download the PDB-style file with coordinates for d1x0gc_.
(The format of our PDB-style files is described here.)

Timeline for d1x0gc_: